General Information

  • ID:  hor000342
  • Uniprot ID:  Q1DH34
  • Protein name:  Allatostatin 1
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  SPKYNFGL
  • Length:  8(81-88)
  • Propeptide:  MRPSTTPMVLLSYLAFVLCLACVAYGSSALGSSSGTSDQSLFGGGAGGGGGSASAESDIGDDRGQQEISQATFQHMLAVRSPKYNFGLGKRRYIIEDVPGAKRLPHYNFGLGKRARNNLLEYDDDSAPSWSEDYSSLIPRDGLDYDGDKDKSAEKRASAYRYHFGLGKRRVYDFGLGKRVYEDKRLPNRYNFGLGRR
  • Signal peptide:  MRPSTTPMVLLSYLAFVLCLACVAYGSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q1DH34-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000342_AF2.pdbhor000342_ESM.pdb

Physical Information

Mass: 105008 Formula: C44H64N10O12
Absent amino acids: ACDEHIMQRTVW Common amino acids: FGKLNPSY
pI: 9.3 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -61.25 Boman Index: -689
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 48.75
Instability Index: 4488.75 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti